4wp2/1/1:B/1:A

Sequences

>4wp2-a1-m1-cB (length=57) [Search sequence]

ATKAQLIAEVSRRTGMNVEYSQMLTGAANWNLELALQSFEQQKANVPPEAFISQPQV

>4wp2-a1-m1-cA (length=60) [Search sequence]

SNAATKAQLIAEVSRRTGMNVEYSQMLTGAANWNLELALQSFEQQKANVPPEAFISQPQV

Structure information

PDB ID	4wp2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Chaetomium Mex67 UBA domain
Assembly ID	1
Resolution	1.7Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	47
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	G0SET4	G0SET4
Species	759272 (Thermochaetoides thermophila DSM 1495)	759272 (Thermochaetoides thermophila DSM 1495)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4wp2-a1-m1-cB_4wp2-a1-m1-cA.pdb.gz

Full biological assembly Download: 4wp2-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures	4wp2/1/1:D/1:C 4wp2/1/1:F/1:E 4wp2/1/1:H/1:G
Other dimers with similar sequences but different poses	4wp2/1/1:F/1:G 4wp2/1/1:B/1:C 4wp2/1/1:D/1:E