4wp2/1/1:F/1:G

Sequences
>4wp2-a1-m1-cF (length=55) [Search sequence]
ATKAQLIAEVSRRTGMNVEYSQMLTGAANWNLELALQSFEQQKANVPPEAFISQP
>4wp2-a1-m1-cG (length=60) [Search sequence]
SNAATKAQLIAEVSRRTGMNVEYSQMLTGAANWNLELALQSFEQQKANVPPEAFISQPQV
Structure information
PDB ID 4wp2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Chaetomium Mex67 UBA domain
Assembly ID 1
Resolution 1.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 40
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID F G
UniProt accession G0SET4 G0SET4
Species 759272 (Thermochaetoides thermophila DSM 1495) 759272 (Thermochaetoides thermophila DSM 1495)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4wp2-a1-m1-cF_4wp2-a1-m1-cG.pdb.gz
Full biological assembly
Download: 4wp2-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4wp2/1/1:B/1:C 4wp2/1/1:D/1:E
Other dimers with similar sequences but different poses
  • 4wp2/1/1:B/1:A 4wp2/1/1:D/1:C 4wp2/1/1:F/1:E 4wp2/1/1:H/1:G
  • [Back to Home]