4x01/1/1:D/1:C

Sequences
>4x01-a1-m1-cD (length=48) [Search sequence]
SVHWSIVYRQLGNLLEQYEVEIARLKSQLVLEKKLRIQVEKEMESVKT
>4x01-a1-m1-cC (length=50) [Search sequence]
SVHWSIVYRQLGNLLEQYEVEIARLKSQLVLEKKLRIQVEKEMESVKTKQ
Structure information
PDB ID 4x01 (database links: RCSB PDB PDBe PDBj PDBsum)
Title S. pombe Ctp1 tetramerization domain
Assembly ID 1
Resolution 2.201Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 51
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D C
UniProt accession O74986 O74986
Species 284812 (Schizosaccharomyces pombe 972h-) 284812 (Schizosaccharomyces pombe 972h-)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4x01-a1-m1-cD_4x01-a1-m1-cC.pdb.gz
Full biological assembly
Download: 4x01-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4x01/1/1:A/1:B 4x01/2/1:E/1:F
Other dimers with similar sequences but different poses
  • 4x01/2/1:G/1:F 4x01/1/1:A/1:C
  • 4x01/2/1:G/1:E 4x01/1/1:B/1:C
  • [Back to Home]