4x01/2/1:G/1:E

Sequences
>4x01-a2-m1-cG (length=44) [Search sequence]
SVHWSIVYRQLGNLLEQYEVEIARLKSQLVLEKKLRIQVEKEME
>4x01-a2-m1-cE (length=46) [Search sequence]
SVHWSIVYRQLGNLLEQYEVEIARLKSQLVLEKKLRIQVEKEMESV
Structure information
PDB ID 4x01 (database links: RCSB PDB PDBe PDBj PDBsum)
Title S. pombe Ctp1 tetramerization domain
Assembly ID 2
Resolution 2.201Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 15
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID G E
UniProt accession O74986 O74986
Species 284812 (Schizosaccharomyces pombe 972h-) 284812 (Schizosaccharomyces pombe 972h-)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4x01-a2-m1-cG_4x01-a2-m1-cE.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4x01-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 4x01/1/1:D/1:C 4x01/1/1:A/1:B 4x01/2/1:E/1:F
  • 4x01/2/1:G/1:F 4x01/1/1:A/1:C
  • [Back to Home]