4x3t/2/1:F/1:C

Sequences

>4x3t-a2-m1-cF (length=56) [Search sequence]

HMGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEK

>4x3t-a2-m1-cC (length=62) [Search sequence]

HMGEQVFAVESIRKKRVRKGKVEYLVKWKGWPPKYSTWEPEEHILDPRLVMAYEEKEERD RA

Structure information

PDB ID	4x3t (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of chromobox homolog 7 (CBX7) chromodomain with MS37452
Assembly ID	2
Resolution	2.14Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	34
Sequence identity between the two chains	1.0
PubMed citation	25660273

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	F	C
UniProt accession	Q8VDS3	Q8VDS3
Species	10090 (Mus musculus)	10090 (Mus musculus)
Function annotation	BioLiP:4x3tF	BioLiP:4x3tC

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4x3t-a2-m1-cF_4x3t-a2-m1-cC.pdb.gz

Full biological assembly Download: 4x3t-assembly2.cif.gz

Similar dimers