4x5m/1/1:A/2:A

Sequences
>4x5m-a1-m1-cA (length=86) [Search sequence]
DTILLTGLFAAFFTTFAFAPQSIKTIRTRNTEGISVVMYIMFLTGVISWIAYGIMRSDFA
VLIANIVTLFLAAPVLVITLINRRKK
>4x5m-a1-m2-cA (length=86) [Search sequence]
DTILLTGLFAAFFTTFAFAPQSIKTIRTRNTEGISVVMYIMFLTGVISWIAYGIMRSDFA
VLIANIVTLFLAAPVLVITLINRRKK
Structure information
PDB ID 4x5m (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of SemiSWEET in the inward-open conformation
Assembly ID 1
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 83
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P0DMV3 P0DMV3
Species 1281200 (Escherichia coli UMEA 3162-1) 1281200 (Escherichia coli UMEA 3162-1)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4x5m-a1-m1-cA_4x5m-a1-m2-cA.pdb.gz
Full biological assembly
Download: 4x5m-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4x5m/2/1:B/1:C 4x5n/1/1:A/1:B

[Back to Home]