4x5s/1/1:A/1:B

Sequences

>4x5s-a1-m1-cA (length=223) [Search sequence]

HWSYEGENGPENWAKLNPEYFWCNLKNQSPVDISDNYKVHAKLEKLHINYNKAVNPEIVN
NGHTIQVNVLEDFKLNIKGKEYHLKQFHFHAPSEHTVNGKYYPLEMHLVHKDKDGNIAVI
GVFFKEGKANPELDKVFKNALKEEGSKVFDGSININALLPPVKNYYTYSGSLTTPPCTEG
VLWIVLKQPITASKQQIELFKSIMKHNNNRPTQPINSRYILES

>4x5s-a1-m1-cB (length=223) [Search sequence]

Structure information

PDB ID	4x5s (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The crystal structure of an alpha carbonic anhydrase from the extremophilic bacterium Sulfurihydrogenibium azorense.
Assembly ID	1
Resolution	1.95Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	75
Sequence identity between the two chains	1.0
PubMed citation	25817590

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	C1DTU5	C1DTU5
Species	309806 (Sulfurihydrogenibium azorense)	309806 (Sulfurihydrogenibium azorense)
Function annotation	BioLiP:4x5sA	BioLiP:4x5sB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	4x5s-a1-m1-cA_4x5s-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	4x5s-assembly1.cif.gz