4x9w/1/1:B/1:A

Sequences
>4x9w-a1-m1-cB (length=2) [Search sequence]
LS
>4x9w-a1-m1-cA (length=226) [Search sequence]
CHLSDMLQQLHSVNASKPSERGLVRQEEAEDPACIPIFWVSKWVDYSDKYGLGYQLCDNS
VGVLFNDSTRLILYNDGDSLQYIERDGTESYLTVSSHPNSLMKKITLLKYFRNYMSEHLL
KAGANITPREGDELARLPYLRTWFRTRSAIILHLSNGSVQINFFQDHTKLILCPLMAAVT
YIDEKRDFRTYRLSLLEEYGCCKELASRLRYARTMVDKLLSSRSAS
Structure information
PDB ID 4x9w (database links: RCSB PDB PDBe PDBj PDBsum)
Title PLK-1 polo-box domain in complex with Bioactive Imidazolium-containing phosphopeptide macrocycle 4C
Assembly ID 1
Resolution 1.798Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 11
Sequence identity between the two chains 1.0
PubMed citation 26152807
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession P53350
Species 32630 (synthetic construct) 9606 (Homo sapiens)
Function annotation BioLiP:4x9wA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4x9w-a1-m1-cB_4x9w-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 4x9w-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4dfw/1/1:D/1:A 4x9r/1/1:B/1:A 4x9v/1/1:B/1:A 6ax4/1/1:C/1:A

[Back to Home]