4xdl/1/1:B/1:A

Sequences

>4xdl-a1-m1-cB (length=257) [Search sequence]

KWKTVVAIFVVVVVYLVTGGLVFRALEQPFESSQKNTIALEKAEFLRDHVCVSPQELETL
IQHALDADNAGVSPIGNSSNNSSHWDLGSAFFFAGTVITTIGYGNIAPSTEGGKIFCILY
AIFGIPLFGFLLAGIGDQLGTIFGKSIARVEKVFRKKQVSQTKIRVISTILFILAGCIVF
VTIPAVIFKYIEGWTALESIYFVVVTLTTVGFGDFVAGGNAGINYREWYKPLVWFWILVG
LAYFAAVLSMIGDWLRV

>4xdl-a1-m1-cA (length=261) [Search sequence]

Structure information

PDB ID	4xdl (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of human two pore domain potassium ion channel TREK2 (K2P10.1) in complex with a brominated fluoxetine derivative.
Assembly ID	1
Resolution	3.5Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	339
Sequence identity between the two chains	1.0
PubMed citation	25766236

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	P57789	P57789
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:4xdlB	BioLiP:4xdlA

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	4xdl-a1-m1-cB_4xdl-a1-m1-cA.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	4xdl-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4bw5/1/1:A/1:B 4bw5/2/1:C/1:D 4xdj/1/1:B/1:A 4xdj/2/1:C/1:D 4xdl/2/1:C/1:D