4xi1/4/2:B/2:A

Sequences

>4xi1-a4-m2-cB (length=75) [Search sequence]

TEIPDIFLCPISKTLIKTPVITAQGKVYDQEALSNFLIATGNKDETGKKLSIDDVVVFDE LYQQIKVYNFYRKRE

>4xi1-a4-m2-cA (length=76) [Search sequence]

YTEIPDIFLCPISKTLIKTPVITAQGKVYDQEALSNFLIATGNKDETGKKLSIDDVVVFD ELYQQIKVYNFYRKRE

Structure information

PDB ID	4xi1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of U-box 2 of LubX / LegU2 / Lpp2887 from Legionella pneumophila str. Paris, wild-type
Assembly ID	4
Resolution	2.983Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	27
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	B	A
UniProt accession	Q5X159	Q5X159
Species	297246 (Legionella pneumophila str. Paris)	297246 (Legionella pneumophila str. Paris)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4xi1-a4-m2-cB_4xi1-a4-m2-cA.pdb.gz

Full biological assembly Download: 4xi1-assembly4.cif.gz

Similar dimers

Other dimers with similar sequences and structures	4xi1/4/1:B/1:A 4xi1/4/1:C/2:C
Other dimers with similar sequences but different poses	4xi1/4/2:C/2:A 4xi1/4/1:B/2:C 4xi1/4/1:C/1:A 4xi1/4/1:C/2:B