4xo1/1/1:A/2:A

Sequences
>4xo1-a1-m1-cA (length=55) [Search sequence]
NIEELKKQAETEIADFIAQKIAENKNTGKEVSERFTAREKTGLESYDVKIKILEH
>4xo1-a1-m2-cA (length=55) [Search sequence]
NIEELKKQAETEIADFIAQKIAENKNTGKEVSERFTAREKTGLESYDVKIKILEH
Structure information
PDB ID 4xo1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title crystal structure of Se-Met GnsA with double mutations
Assembly ID 1
Resolution 1.802Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 84
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P0AC92 P0AC92
Species 83333 (Escherichia coli K-12) 83333 (Escherichia coli K-12)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4xo1-a1-m1-cA_4xo1-a1-m2-cA.pdb.gz
Full biological assembly
Download: 4xo1-assembly1.cif.gz

[Back to Home]