4ybh/1/1:B/2:B

Sequences
>4ybh-a1-m1-cB (length=89) [Search sequence]
ACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLD
RNKDQEVNFQEYVTFLGALALIYNEALKG
>4ybh-a1-m2-cB (length=89) [Search sequence]
ACPLDQAIGLLVAIFHKYSGREGDKHTLSKKELKELIQKELTIGSKLQDAEIARLMEDLD
RNKDQEVNFQEYVTFLGALALIYNEALKG
Structure information
PDB ID 4ybh (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the human RAGE ectodomain (VC1C2 fragment) in complex with human S100A6
Assembly ID 1
Resolution 2.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 84
Sequence identity between the two chains 1.0
PubMed citation 27818100
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B B
UniProt accession P06703 P06703
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:4ybhB BioLiP:4ybhB
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4ybh-a1-m1-cB_4ybh-a1-m2-cB.pdb.gz
Full biological assembly
Download: 4ybh-assembly1.cif.gz

[Back to Home]