4yeh/1/1:A/1:B

Sequences

>4yeh-a1-m1-cA (length=224) [Search sequence]

GYINAAFRSSRNNEAYLFINDKYVLLDYAPGTSNDKVLYGPSFVRDGYKSLAKTIFGTYG
IDCSFDTEYNEAFIFYENFCARIDYAPHSDKDKIISGPKKIADMFPFFKGTVFENGIDAA
FRSTKGKEVYLFKGDKYARIDYLTNRLVQNIKSISDGFPCLRGTIFEAGMDSAFASHKTN
EAYLFKGEYYARINFTPGSTNDIMGGVKKTLDYWPSLRGIIPLE

>4yeh-a1-m1-cB (length=224) [Search sequence]

Structure information

PDB ID	4yeh (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Mg2+ ion containing hemopexin fold from Kabuli chana (chickpea white) at 2.45A resolution reveals a structural basis of metal ion transport
Assembly ID	1
Resolution	2.45Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	30
Sequence identity between the two chains	1.0
PubMed citation	26242869

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	G1K3R9	G1K3R9
Species	3827 (Cicer arietinum)	3827 (Cicer arietinum)
Function annotation	BioLiP:4yehA	BioLiP:4yehB

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	4yeh-a1-m1-cA_4yeh-a1-m1-cB.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	4yeh-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

3s18/1/1:A/1:B 3v6n/1/1:A/1:B 4oei/1/1:A/1:B