4yj0/1/1:A/1:B

Sequences

>4yj0-a1-m1-cA (length=62) [Search sequence]

SPRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCNLIAERQRVMAAQVALRRQQAQEE EL

>4yj0-a1-m1-cB (length=63) [Search sequence]

KSPRLPKCARCRNHGYASPLKGHKRFCMWRDCQCKKCNLIAERQRVMAAQVALRRQQAQE EEL

Structure information

PDB ID	4yj0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the DM domain of human DMRT1 bound to 25mer target DNA
Assembly ID	1
Resolution	3.814Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	25
Sequence identity between the two chains	1.0
PubMed citation	26005864

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	Q9Y5R6	Q9Y5R6
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:4yj0A	BioLiP:4yj0B

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 4yj0-a1-m1-cA_4yj0-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 4yj0-assembly1.cif.gz