4ynh/1/1:A/1:B

Sequences
>4ynh-a1-m1-cA (length=58) [Search sequence]
PLGSKIASAREVIKRDGVIPPEALTIIEQRLRSDPMFRQQIDNVLADAECDANRAAYS
>4ynh-a1-m1-cB (length=58) [Search sequence]
GPLGSKIASAREVIKRDGVIPPEALTIIEQRLRSDPMFRQQIDNVLADAECDANRAAY
Structure information
PDB ID 4ynh (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the C. elegans SAS-5 Implico dimerization domain
Assembly ID 1
Resolution 1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 93
Sequence identity between the two chains 0.983
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q20010 Q20010
Species 6239 (Caenorhabditis elegans) 6239 (Caenorhabditis elegans)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4ynh-a1-m1-cA_4ynh-a1-m1-cB.pdb.gz
Full biological assembly
Download: 4ynh-assembly1.cif.gz

[Back to Home]