4yv4/3/1:E/1:H

Sequences
>4yv4-a3-m1-cE (length=53) [Search sequence]
EQAAENWRDAMKTELQTIRTEIQEETARRQEELNAQNLVKMQELMSNFFQKIT
>4yv4-a3-m1-cH (length=57) [Search sequence]
GPTEEQAAENWRDAMKTELQTIRTEIQEETARRQEELNAQNLVKMQELMSNFFQKIT
Structure information
PDB ID 4yv4 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Structure of the C. elegans SAS-5 coiled coil domain
Assembly ID 3
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 20
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E H
UniProt accession Q20010 Q20010
Species 6239 (Caenorhabditis elegans) 6239 (Caenorhabditis elegans)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4yv4-a3-m1-cE_4yv4-a3-m1-cH.pdb.gz
Full biological assembly
Download: 4yv4-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 4yv4/2/1:B/1:D 4yv4/2/1:D/1:C 4yv4/3/1:E/1:G 4yv4/3/1:G/1:H
  • [Back to Home]