4z8e/4/2:C/1:B

Sequences
>4z8e-a4-m2-cC (length=55) [Search sequence]
GVWSPDIEQSFQEALSIYPGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLAR
>4z8e-a4-m1-cB (length=58) [Search sequence]
DAEGVWSPDIEQSFQEALSIYPGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLAR
Structure information
PDB ID 4z8e (database links: RCSB PDB PDBe PDBj PDBsum)
Title TEAD DBD mutant -deltaL1
Assembly ID 4
Resolution 2.092Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 81
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 2 1
Chain ID C B
UniProt accession P28347 P28347
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 4z8e-a4-m2-cC_4z8e-a4-m1-cB.pdb.gz
Full biological assembly
Download: 4z8e-assembly4.cif.gz
Similar dimers
Other dimers with similar sequences and structures 4z8e/4/1:A/2:A 4z8e/4/1:C/2:B
Other dimers with similar sequences but different poses
  • 4z8e/4/2:C/2:A 4z8e/4/1:B/2:B 4z8e/4/1:C/1:A
  • [Back to Home]