4z8e/4/2:C/2:A

Sequences

>4z8e-a4-m2-cC (length=55) [Search sequence]

GVWSPDIEQSFQEALSIYPGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLAR

>4z8e-a4-m2-cA (length=59) [Search sequence]

NDAEGVWSPDIEQSFQEALSIYPGKMYGRNELIARYIKLRTGKTRTRKQVSSHIQVLAR

Structure information

PDB ID	4z8e (database links: RCSB PDB PDBe PDBj PDBsum)
Title	TEAD DBD mutant -deltaL1
Assembly ID	4
Resolution	2.092Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	31
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	2	2
Chain ID	C	A
UniProt accession	P28347	P28347
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 4z8e-a4-m2-cC_4z8e-a4-m2-cA.pdb.gz

Full biological assembly Download: 4z8e-assembly4.cif.gz

Similar dimers

Other dimers with similar sequences and structures	4z8e/4/1:B/2:B 4z8e/4/1:C/1:A
Other dimers with similar sequences but different poses	4z8e/4/2:C/1:B 4z8e/4/1:A/2:A 4z8e/4/1:C/2:B