4zid/1/1:A/2:A

Sequences
>4zid-a1-m1-cA (length=80) [Search sequence]
NEQLAKQKGCMACHDLKAKKVGPAYADVAKKYAGRKDAVDYLAGKIKKGGSGVWGSVPMP
PQNVTDAEAKQLAQWILSIK
>4zid-a1-m2-cA (length=80) [Search sequence]
NEQLAKQKGCMACHDLKAKKVGPAYADVAKKYAGRKDAVDYLAGKIKKGGSGVWGSVPMP
PQNVTDAEAKQLAQWILSIK
Structure information
PDB ID 4zid (database links: RCSB PDB PDBe PDBj PDBsum)
Title Dimeric Hydrogenobacter thermophilus cytochrome c552 obtained from Escherichia coli
Assembly ID 1
Resolution 1.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 83
Sequence identity between the two chains 1.0
PubMed citation 26838805
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P15452 P15452
Species 608538 (Hydrogenobacter thermophilus TK-6) 608538 (Hydrogenobacter thermophilus TK-6)
Function annotation BioLiP:4zidA BioLiP:4zidA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 4zid-a1-m1-cA_4zid-a1-m2-cA.pdb.gz
Full biological assembly
Download: 4zid-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 1ynr/1/1:D/1:C 1ynr/1/1:B/1:A
  • 1ynr/1/1:D/1:A 1ynr/1/1:B/1:C
  • 5aur/2/1:E/1:G 5aur/1/1:A/1:C
  • [Back to Home]