5ab8/1/1:A/2:A

Sequences
>5ab8-a1-m1-cA (length=117) [Search sequence]
PISIYDKIGGHEAIEVVVEDFYVRVLADDQLSAFFSGTNMSRLKGKQVEFFAAALGGPEP
YTGAPMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTS
>5ab8-a1-m2-cA (length=117) [Search sequence]
PISIYDKIGGHEAIEVVVEDFYVRVLADDQLSAFFSGTNMSRLKGKQVEFFAAALGGPEP
YTGAPMKQVHQGRGITMHHFSLVAGHLADALTAAGVPSETITEILGVIAPLAVDVTS
Structure information
PDB ID 5ab8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title High resolution X-ray structure of the N-terminal truncated form (residues 1-11) of Mycobacterium tuberculosis HbN
Assembly ID 1
Resolution 1.53Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 93
Sequence identity between the two chains 1.0
PubMed citation 26499089
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession P9WN25 P9WN25
Species 1773 (Mycobacterium tuberculosis) 1773 (Mycobacterium tuberculosis)
Function annotation BioLiP:5ab8A BioLiP:5ab8A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5ab8-a1-m1-cA_5ab8-a1-m2-cA.pdb.gz
Full biological assembly
Download: 5ab8-assembly1.cif.gz

[Back to Home]