5al6/1/3:A/4:A

Sequences
>5al6-a1-m3-cA (length=44) [Search sequence]
SDLAALVSLVESVRHEQQQLRNLCEMILEQQQRAKEFGENLYFQ
>5al6-a1-m4-cA (length=44) [Search sequence]
SDLAALVSLVESVRHEQQQLRNLCEMILEQQQRAKEFGENLYFQ
Structure information
PDB ID 5al6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Central Coiled-Coil Domain (CCCD) of Drosophila melanogaster Ana2. A natural, parallel, tetrameric coiled-coil bundle.
Assembly ID 1
Resolution 0.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 53
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 3 4
Chain ID A A
UniProt accession Q9XZ31 Q9XZ31
Species 7227 (Drosophila melanogaster) 7227 (Drosophila melanogaster)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5al6-a1-m3-cA_5al6-a1-m4-cA.pdb.gz
Full biological assembly
Download: 5al6-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5al6/1/1:A/2:A 5al6/1/1:A/4:A 5al6/1/2:A/3:A

[Back to Home]