5aq0/1/1:A/1:B

Sequences

>5aq0-a1-m1-cA (length=81) [Search sequence]

SGVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGYMPLT VTNVVVKEGPATEVDFSLRPH

>5aq0-a1-m1-cB (length=82) [Search sequence]

SGVKGFVKDSITGSGLENATISVAGINHNITTGRFGDFYRLLVPGTYNLTVVLTGYMPLT VTNVVVKEGPATEVDFSLRPHH

Structure information

PDB ID	5aq0 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The structure of the Transthyretin-like domain of the first catalytic domain of the HUMAN Carboxypeptidase D
Assembly ID	1
Resolution	0.95Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	22
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	A	B
UniProt accession	O75976	O75976
Species	9606 (Homo sapiens)	9606 (Homo sapiens)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5aq0-a1-m1-cA_5aq0-a1-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5aq0-assembly1.cif.gz