5ay8/1/1:E/1:A

Sequences
>5ay8-a1-m1-cE (length=96) [Search sequence]
PHRYKPGTLALREIRKYQKSTQLLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASE
AYLVQLFEDTNLCAIHARRVTIMPRDMQLARRLRRE
>5ay8-a1-m1-cA (length=97) [Search sequence]
PHRYKPGTLALREIRKYQKSTQLLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASE
AYLVQLFEDTNLCAIHARRVTIMPRDMQLARRLRREG
Structure information
PDB ID 5ay8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of human nucleosome containing H3.Y
Assembly ID 1
Resolution 2.8Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 31
Sequence identity between the two chains 1.0
PubMed citation 27016736
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E A
UniProt accession P0DPK2 P0DPK2
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:5ay8E BioLiP:5ay8A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5ay8-a1-m1-cE_5ay8-a1-m1-cA.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 5ay8-assembly1.cif.gz

[Back to Home]