5ay8/1/1:E/1:A

Sequences

>5ay8-a1-m1-cE (length=96) [Search sequence]

PHRYKPGTLALREIRKYQKSTQLLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASE AYLVQLFEDTNLCAIHARRVTIMPRDMQLARRLRRE

>5ay8-a1-m1-cA (length=97) [Search sequence]

PHRYKPGTLALREIRKYQKSTQLLLRKLPFQRLVREIAQAISPDLRFQSAAIGALQEASE AYLVQLFEDTNLCAIHARRVTIMPRDMQLARRLRREG

Structure information

PDB ID	5ay8 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of human nucleosome containing H3.Y
Assembly ID	1
Resolution	2.8Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	31
Sequence identity between the two chains	1.0
PubMed citation	27016736

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	A
UniProt accession	P0DPK2	P0DPK2
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:5ay8E	BioLiP:5ay8A

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5ay8-a1-m1-cE_5ay8-a1-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5ay8-assembly1.cif.gz