5b52/1/1:A/1:B

Sequences
>5b52-a1-m1-cA (length=57) [Search sequence]
LAEFAAAEKALQEQMAQLEALKKDAGLKREIEFEQKLVGLMKSYDKSLRDIIAILDP
>5b52-a1-m1-cB (length=60) [Search sequence]
RLAEFAAAEKALQEQMAQLEALKKDAGLKREIEFEQKLVGLMKSYDKSLRDIIAILDPKL
Structure information
PDB ID 5b52 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the N-terminal domain of H-NS family protein TurB
Assembly ID 1
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 44
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession Q88GF9 Q88GF9
Species 160488 (Pseudomonas putida KT2440) 160488 (Pseudomonas putida KT2440)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5b52-a1-m1-cA_5b52-a1-m1-cB.pdb.gz
Full biological assembly
Download: 5b52-assembly1.cif.gz

[Back to Home]