5b7y/1/1:B/1:A

Sequences

>5b7y-a1-m1-cB (length=268) [Search sequence]

MKLSLVISTSDAAFDALAFKGDLRKGMELAKRVGYQAVEIAVRDPSIVDWNEVKILSEEL
NLPICAIGTGQAYLADGLSLTHPNDEIRKKAIERVVKHTEVAGMFGALVIIGLVRGRREG
RSYEETEELFIESMKRLLELTEHAKFVIEPLNRYETDFINTIDDALRILRKINSNRVGIL
ADTFHMNIEEVNIPESLKRAGEKLYHFHVADSNRWAPGCGHFDFRSVFNTLKEIGYNRYV
SVECLPLPGGMEEAAEIAFKTLKELIIK

>5b7y-a1-m1-cA (length=269) [Search sequence]

Structure information

PDB ID	5b7y (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of Hyperthermophilic Thermotoga maritima L-Ketose-3-Epimerase with Co2+
Assembly ID	1
Resolution	1.32Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	15
Sequence identity between the two chains	1.0
PubMed citation	28258150

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	Q9WYP7	Q9WYP7
Species	243274 (Thermotoga maritima MSB8)	243274 (Thermotoga maritima MSB8)
Function annotation	BioLiP:5b7yB	BioLiP:5b7yA

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	5b7y-a1-m1-cB_5b7y-a1-m1-cA.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	5b7y-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences and structures

5b7z/1/1:B/1:A 5b80/1/1:B/1:A