5b83/2/1:E/1:F

Sequences
>5b83-a2-m1-cE (length=50) [Search sequence]
KQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAVLLKE
>5b83-a2-m1-cF (length=59) [Search sequence]
MKQTIAKQEEDLETMTILRAQMEVYCSDFHAERAAREKIHEEKEQLALQLAVLLKENDA
Structure information
PDB ID 5b83 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Optineurin UBAN in complex with linear ubiquitin
Assembly ID 2
Resolution 2.694Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 73
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E F
UniProt accession Q96CV9 Q96CV9
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5b83-a2-m1-cE_5b83-a2-m1-cF.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 5b83-assembly2.cif.gz
Similar dimers

[Back to Home]