5bu7/1/1:B/2:B

Sequences
>5bu7-a1-m1-cB (length=106) [Search sequence]
ADLEDNMETLNDNLKVIEKADNAAQVEKALEKMLAAAADALKATPPKLEDKSPDSPEMHD
FRHGFAILMGQIHDAAHLANEGKVKEAQAAAEQLKCTCNACHQKYR
>5bu7-a1-m2-cB (length=106) [Search sequence]
ADLEDNMETLNDNLKVIEKADNAAQVEKALEKMLAAAADALKATPPKLEDKSPDSPEMHD
FRHGFAILMGQIHDAAHLANEGKVKEAQAAAEQLKCTCNACHQKYR
Structure information
PDB ID 5bu7 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of an engineered protein that forms nanotubes with tunable diameters
Assembly ID 1
Resolution 2.46Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 15
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B B
UniProt accession P0ABE7 P0ABE7
Species 562 (Escherichia coli) 562 (Escherichia coli)
Function annotation BioLiP:5bu7B BioLiP:5bu7B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5bu7-a1-m1-cB_5bu7-a1-m2-cB.pdb.gz
Full biological assembly
Download: 5bu7-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 3tom/3/1:C/1:D 3tol/1/1:A/1:B 3tol/2/1:C/1:D 3tom/1/1:C/1:D 3tom/2/1:A/1:B 3tom/3/1:A/1:B 5bu7/1/1:A/1:B 5bu7/1/2:A/2:B
  • 5bu7/1/1:A/2:B 5bu7/1/1:B/2:A
  • [Back to Home]