5bum/1/1:A/1:B

Sequences
>5bum-a1-m1-cA (length=49) [Search sequence]
CTSYYTVKSGDICYNIAQTYGIDVATLQSYNPGLQCDNLQIGQQLCVAD
>5bum-a1-m1-cB (length=49) [Search sequence]
CTSYYTVKSGDICYNIAQTYGIDVATLQSYNPGLQCDNLQIGQQLCVAD
Structure information
PDB ID 5bum (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of LysM domain from Equisetum arvense chitinase A
Assembly ID 1
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 27
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID A B
UniProt accession C7G3I3 C7G3I3
Species 3258 (Equisetum arvense) 3258 (Equisetum arvense)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5bum-a1-m1-cA_5bum-a1-m1-cB.pdb.gz
Full biological assembly
Download: 5bum-assembly1.cif.gz

[Back to Home]