5bxx/2/1:C/1:D

Sequences
>5bxx-a2-m1-cC (length=111) [Search sequence]
MIVRNLGDIRKTDRNVRSDGWASARMLLKDDGMGFSFHVTTLFAGSELRMHYQNHLEAVL
VLKGTGTIEDLATGEVHALRPGVMYALDDHDRHIVRPETDILTACVFNPPV
>5bxx-a2-m1-cD (length=112) [Search sequence]
MIVRNLGDIRKTDRNVRSDGWASARMLLKDDGMGFSFHVTTLFAGSELRMHYQNHLEAVL
VLKGTGTIEDLATGEVHALRPGVMYALDDHDRHIVRPETDILTACVFNPPVT
Structure information
PDB ID 5bxx (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the ectoine synthase from the cold-adapted marine bacterium Sphingopyxis alaskensis
Assembly ID 2
Resolution 2Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 121
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession Q1GNW6 Q1GNW6
Species 317655 (Sphingopyxis alaskensis RB2256) 317655 (Sphingopyxis alaskensis RB2256)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5bxx-a2-m1-cC_5bxx-a2-m1-cD.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 5bxx-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5bxx/1/1:B/1:A 5by5/1/1:A/2:A

[Back to Home]