5bxx/2/1:C/1:D

Sequences

>5bxx-a2-m1-cC (length=111) [Search sequence]

MIVRNLGDIRKTDRNVRSDGWASARMLLKDDGMGFSFHVTTLFAGSELRMHYQNHLEAVL VLKGTGTIEDLATGEVHALRPGVMYALDDHDRHIVRPETDILTACVFNPPV

>5bxx-a2-m1-cD (length=112) [Search sequence]

MIVRNLGDIRKTDRNVRSDGWASARMLLKDDGMGFSFHVTTLFAGSELRMHYQNHLEAVL VLKGTGTIEDLATGEVHALRPGVMYALDDHDRHIVRPETDILTACVFNPPVT

Structure information

PDB ID	5bxx (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the ectoine synthase from the cold-adapted marine bacterium Sphingopyxis alaskensis
Assembly ID	2
Resolution	2Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	121
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	C	D
UniProt accession	Q1GNW6	Q1GNW6
Species	317655 (Sphingopyxis alaskensis RB2256)	317655 (Sphingopyxis alaskensis RB2256)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5bxx-a2-m1-cC_5bxx-a2-m1-cD.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5bxx-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

5bxx/1/1:B/1:A 5by5/1/1:A/2:A