5by6/2/1:D/1:C

Sequences

>5by6-a2-m1-cD (length=282) [Search sequence]

YVNQEELNYLNQLKDIIDHGVRKNDRTGIGTLSTFGTQSRYCLRDDIFPLLTTKRVFWRG
VVEELLWFISGSTNAKQLSEKNVNIWDGNSSREFLDSRGLYNYEEGDLGPVYGFQWRHFG
CPYSSMTADYKGKGYDQLQQCIKMIREEPESRRIIMTAWNPCDLEKVALPPCHCFVQFYV
ADGELSCQMYQRSADMGLGVPFNIASYSLLTRMIAHITSLKPGFFIHTIGDAHVYLTHVD
ALKVQMERKPRPFPKLKILRNVENIDDFRAEDFELINYKPYP

>5by6-a2-m1-cC (length=286) [Search sequence]

Structure information

PDB ID	5by6 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of Trichinella spiralis thymidylate synthase complexed with dUMP
Assembly ID	2
Resolution	1.9Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	123
Sequence identity between the two chains	1.0
PubMed citation	28826032

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	C
UniProt accession	Q9NDD3	Q9NDD3
Species	6334 (Trichinella spiralis)	6334 (Trichinella spiralis)
Function annotation	BioLiP:5by6D	BioLiP:5by6C

3D structure

Switch viewer: [NGL] [JSmol]

Dimer structure: Chain 1 in red; Chain 2 in blue.

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black] [White]
Download:	5by6-a2-m1-cD_5by6-a2-m1-cC.pdb.gz

Full biological assembly

Color:	[By chain] [By residue index]
Spin:	[Spin off] [Spin on] [Reset]
Render:	[Low quality] [High quality]
Background:	[Black quality] [White quality]
Download:	5by6-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

5by6/1/1:A/1:B 5m4z/1/1:B/1:A