5c13/2/1:C/1:G

Sequences
>5c13-a2-m1-cC (length=59) [Search sequence]
MYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMTAPPEEMQWFCPKC
>5c13-a2-m1-cG (length=59) [Search sequence]
MYVIRDEWGNQIWICPGCNKPDDGSPMIGCDDCDDWYHWPCVGIMTAPPEEMQWFCPKC
Structure information
PDB ID 5c13 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of TAF3 PHD finger bound to histone H3C4me3 peptide
Assembly ID 2
Resolution 2.101Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 20
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C G
UniProt accession Q5VWG9 Q5VWG9
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:5c13C BioLiP:5c13G
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5c13-a2-m1-cC_5c13-a2-m1-cG.pdb.gz
Full biological assembly
Download: 5c13-assembly2.cif.gz
Similar dimers

[Back to Home]