5c4q/3/1:B/1:A

Sequences

>5c4q-a3-m1-cB (length=114) [Search sequence]

DVSKRPREEFHKEQCLSFVKKLWAADTLAMFHYPVSATEVPGYYDVVDTPMDLSTIRKNI EQGKYRTDTEVENDVVLMLSNALDFNEKGSQWHDLAKQLKKRYLTLAQESGLSF

>5c4q-a3-m1-cA (length=118) [Search sequence]

MDVSKRPREEFHKEQCLSFVKKLWAADTLAMFHYPVSATEVPGYYDVVDTPMDLSTIRKN IEQGKYRTDTEVENDVVLMLSNALDFNEKGSQWHDLAKQLKKRYLTLAQESGLSFDAD

Structure information

PDB ID	5c4q (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure Analysis of bromodomain from Leishmania donovani complexed with bromosporine
Assembly ID	3
Resolution	1.932Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	40
Sequence identity between the two chains	1.0
PubMed citation

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	B	A
UniProt accession	A0A3Q8IW45	A0A3Q8IW45
Species	981087 (Leishmania donovani BPK282A1)	981087 (Leishmania donovani BPK282A1)
Function annotation	BioLiP:5c4qB	BioLiP:5c4qA

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5c4q-a3-m1-cB_5c4q-a3-m1-cA.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5c4q-assembly3.cif.gz