5cos/1/1:C/1:D

Sequences
>5cos-a1-m1-cC (length=58) [Search sequence]
SIPGEVAEQAMHWHLELQEPAVSAATLAACMSWRQAHPLHEHAWQRTQVFAQRLREMR
>5cos-a1-m1-cD (length=61) [Search sequence]
GATSIPGEVAEQAMHWHLELQEPAVSAATLAACMSWRQAHPLHEHAWQRTQVFAQRLREM
R
Structure information
PDB ID 5cos (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the Cytoplasmic Domain of the Pseudomonas putida Anti-sigma Factor PupR
Assembly ID 1
Resolution 2.019Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 51
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C D
UniProt accession
Species 1495066 (Pseudomonas capeferrum) 1495066 (Pseudomonas capeferrum)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5cos-a1-m1-cC_5cos-a1-m1-cD.pdb.gz
Full biological assembly
Download: 5cos-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 5cos/2/1:B/1:A 5cam/2/1:B/1:A
  • [Back to Home]