5cos/2/1:B/1:A

Sequences
>5cos-a2-m1-cB (length=55) [Search sequence]
GEVAEQAMHWHLELQEPAVSAATLAACMSWRQAHPLHEHAWQRTQVFAQRLREMR
>5cos-a2-m1-cA (length=56) [Search sequence]
PGEVAEQAMHWHLELQEPAVSAATLAACMSWRQAHPLHEHAWQRTQVFAQRLREMR
Structure information
PDB ID 5cos (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of the Cytoplasmic Domain of the Pseudomonas putida Anti-sigma Factor PupR
Assembly ID 2
Resolution 2.019Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 40
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B A
UniProt accession
Species 1495066 (Pseudomonas capeferrum) 1495066 (Pseudomonas capeferrum)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5cos-a2-m1-cB_5cos-a2-m1-cA.pdb.gz
Full biological assembly
Download: 5cos-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 5cos/1/1:C/1:D 5cam/1/1:C/1:D
  • [Back to Home]