5cq2/1/1:A/4:A

Sequences

>5cq2-a1-m1-cA (length=76) [Search sequence]

GPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQEKPLPEGWEMRFTVDGIPYFVDHNR RTTTYIDPRTGKSALD

>5cq2-a1-m4-cA (length=76) [Search sequence]

GPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQEKPLPEGWEMRFTVDGIPYFVDHNR RTTTYIDPRTGKSALD

Structure information

PDB ID	5cq2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal Structure of tandem WW domains of ITCH in complex with TXNIP peptide
Assembly ID	1
Resolution	1.4Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	10
Sequence identity between the two chains	1.0
PubMed citation	26527736

Chain information

	Chain 1	Chain 2
Model ID	1	4
Chain ID	A	A
UniProt accession	Q96J02	Q96J02
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:5cq2A	BioLiP:5cq2A

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5cq2-a1-m1-cA_5cq2-a1-m4-cA.pdb.gz

Full biological assembly Download: 5cq2-assembly1.cif.gz

Similar dimers

Other dimers with similar sequences but different poses

5cq2/1/3:A/4:A 5cq2/1/1:A/2:A 5dzd/1/1:A/1:B 5cq2/1/2:A/4:A 5cq2/1/1:A/3:A