5cq2/1/3:A/4:A

Sequences
>5cq2-a1-m3-cA (length=76) [Search sequence]
GPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQEKPLPEGWEMRFTVDGIPYFVDHNR
RTTTYIDPRTGKSALD
>5cq2-a1-m4-cA (length=76) [Search sequence]
GPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQEKPLPEGWEMRFTVDGIPYFVDHNR
RTTTYIDPRTGKSALD
Structure information
PDB ID 5cq2 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of tandem WW domains of ITCH in complex with TXNIP peptide
Assembly ID 1
Resolution 1.4Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 39
Sequence identity between the two chains 1.0
PubMed citation 26527736
Chain information
Chain 1 Chain 2
Model ID 3 4
Chain ID A A
UniProt accession Q96J02 Q96J02
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:5cq2A BioLiP:5cq2A
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5cq2-a1-m3-cA_5cq2-a1-m4-cA.pdb.gz
Full biological assembly
Download: 5cq2-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5cq2/1/1:A/2:A 5dzd/1/1:A/1:B
Other dimers with similar sequences but different poses
  • 5cq2/1/2:A/4:A 5cq2/1/1:A/3:A
  • 5cq2/1/1:A/4:A 5cq2/1/2:A/3:A
  • [Back to Home]