5cwt/2/1:D/1:C

Sequences
>5cwt-a2-m1-cD (length=35) [Search sequence]
IEAKAKKILEDYDKQLQHLKKQVEEAKKDFEEWEK
>5cwt-a2-m1-cC (length=40) [Search sequence]
GLGEEIEAKAKKILEDYDKQLQHLKKQVEEAKKDFEEWEK
Structure information
PDB ID 5cwt (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of Chaetomium thermophilum Nup57
Assembly ID 2
Resolution 2.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 40
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D C
UniProt accession G0S0R2 G0S0R2
Species 759272 (Thermochaetoides thermophila DSM 1495) 759272 (Thermochaetoides thermophila DSM 1495)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5cwt-a2-m1-cD_5cwt-a2-m1-cC.pdb.gz
Full biological assembly
Download: 5cwt-assembly2.cif.gz
Similar dimers

[Back to Home]