5cx3/3/1:D/1:B

Sequences
>5cx3-a3-m1-cD (length=117) [Search sequence]
RPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELV
KIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF
>5cx3-a3-m1-cB (length=118) [Search sequence]
DRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSEL
VKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF
Structure information
PDB ID 5cx3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of FYCO1 LIR in complex with LC3A
Assembly ID 3
Resolution 2.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 38
Sequence identity between the two chains 1.0
PubMed citation 27246247
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID D B
UniProt accession Q9H492 Q9H492
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:5cx3D BioLiP:5cx3B
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5cx3-a3-m1-cD_5cx3-a3-m1-cB.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 5cx3-assembly3.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5cx3/1/1:A/1:C 5cx3/2/1:D/1:B 5cx3/3/1:A/1:C

[Back to Home]