5cx3/3/1:D/1:B

Sequences

>5cx3-a3-m1-cD (length=117) [Search sequence]

RPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELV KIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF

>5cx3-a3-m1-cB (length=118) [Search sequence]

DRPFKQRRSFADRCKEVQQIRDQHPSKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSEL VKIIRRRLQLNPTQAFFLLVNQHSMVSVSTPIADIYEQEKDEDGFLYMVYASQETFGF

Structure information

PDB ID	5cx3 (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of FYCO1 LIR in complex with LC3A
Assembly ID	3
Resolution	2.3Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	38
Sequence identity between the two chains	1.0
PubMed citation	27246247

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	B
UniProt accession	Q9H492	Q9H492
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:5cx3D	BioLiP:5cx3B

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5cx3-a3-m1-cD_5cx3-a3-m1-cB.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5cx3-assembly3.cif.gz

Similar dimers

Other dimers with similar sequences and structures

5cx3/1/1:A/1:C 5cx3/2/1:D/1:B 5cx3/3/1:A/1:C