5dgf/2/1:p2/1:p1

Sequences
>5dgf-a2-m1-cp2 (length=46) [Search sequence]
MSTESALSYAALILADSEIEISSEKLLTLTNAANVPVENIWADIFA
>5dgf-a2-m1-cp1 (length=47) [Search sequence]
MSTESALSYAALILADSEIEISSEKLLTLTNAANVPVENIWADIFAK
Structure information
PDB ID 5dgf (database links: RCSB PDB PDBe PDBj PDBsum)
Title Complex of yeast 80S ribosome with hypusine-containing/non-modified eIF5A and/or a peptidyl-tRNA analog
Assembly ID 2
Resolution 3.3Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 28
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID p2 p1
UniProt accession P05318 P05318
Species 559292 (Saccharomyces cerevisiae S288C) 559292 (Saccharomyces cerevisiae S288C)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5dgf-a2-m1-cp2_5dgf-a2-m1-cp1.pdb.gz
Full biological assembly
Download: 5dgf-assembly2.cif.gz
Similar dimers

[Back to Home]