5dnf/1/1:E/1:G

Sequences
>5dnf-a1-m1-cE (length=65) [Search sequence]
SSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYIN
SLEMS
>5dnf-a1-m1-cG (length=65) [Search sequence]
SSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYIN
SLEMS
Structure information
PDB ID 5dnf (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of CC chemokine 5 (CCL5) oligomer in complex with heparin
Assembly ID 1
Resolution 2.549Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 31
Sequence identity between the two chains 1.0
PubMed citation 27091995
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E G
UniProt accession P13501 P13501
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:5dnfG
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5dnf-a1-m1-cE_5dnf-a1-m1-cG.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 5dnf-assembly1.cif.gz

[Back to Home]