5dnf/1/1:E/1:G

Sequences

>5dnf-a1-m1-cE (length=65) [Search sequence]

SSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYIN SLEMS

>5dnf-a1-m1-cG (length=65) [Search sequence]

SSDTTPCCFAYIARPLPRAHIKEYFYTSGKCSNPAVVFVTRKNRQVCANPEKKWVREYIN SLEMS

Structure information

PDB ID	5dnf (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of CC chemokine 5 (CCL5) oligomer in complex with heparin
Assembly ID	1
Resolution	2.549Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	31
Sequence identity between the two chains	1.0
PubMed citation	27091995

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	E	G
UniProt accession	P13501	P13501
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:5dnfG

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black]   [White]   Download: 5dnf-a1-m1-cE_5dnf-a1-m1-cG.pdb.gz

Full biological assembly Color: [By chain]   [By residue index]   Spin: [Spin off]   [Spin on]   [Reset] Render: [Low quality]   [High quality]   Background: [Black quality]   [White quality]   Download: 5dnf-assembly1.cif.gz