5dol/1/1:B/2:B

Sequences
>5dol-a1-m1-cB (length=62) [Search sequence]
MDKKELFDTVINLEEQIGSLYRQLGDLKQHIGEMIEENHHLQLENKHLRKRLDDTTQQIE
KF
>5dol-a1-m2-cB (length=62) [Search sequence]
MDKKELFDTVINLEEQIGSLYRQLGDLKQHIGEMIEENHHLQLENKHLRKRLDDTTQQIE
KF
Structure information
PDB ID 5dol (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of YabA amino-terminal domain from Bacillus subtilis
Assembly ID 1
Resolution 2.7Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 46
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID B B
UniProt accession P37542 P37542
Species 224308 (Bacillus subtilis subsp. subtilis str. 168) 224308 (Bacillus subtilis subsp. subtilis str. 168)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5dol-a1-m1-cB_5dol-a1-m2-cB.pdb.gz
Full biological assembly
Download: 5dol-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences but different poses
  • 5dol/1/2:A/2:B 5dol/1/1:A/1:B
  • 5dol/1/1:A/2:B 5dol/1/2:A/1:B
  • [Back to Home]