5ds1/2/1:B/1:C

Sequences
>5ds1-a2-m1-cB (length=90) [Search sequence]
STPADVKEHPNSYVFMVDMPGVKSGDIKVQVEDENVLLISGERKREKEGVKYLKMERRIG
KLMRKFVLPENNIEAISAISQDGVLTVTVN
>5ds1-a2-m1-cC (length=90) [Search sequence]
STPADVKEHPNSYVFMVDMPGVKSGDIKVQVEDENVLLISGERKREKEGVKYLKMERRIG
KLMRKFVLPENIEAISAISQDGVLTVTVNK
Structure information
PDB ID 5ds1 (database links: RCSB PDB PDBe PDBj PDBsum)
Title Core domain of the class II small heat-shock protein HSP 17.7 from Pisum sativum
Assembly ID 2
Resolution 2.63Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 94
Sequence identity between the two chains 0.989
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID B C
UniProt accession P19242 P19242
Species 3888 (Pisum sativum) 3888 (Pisum sativum)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5ds1-a2-m1-cB_5ds1-a2-m1-cC.pdb.gz
Full biological assembly
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black quality]   [White quality]  
Download: 5ds1-assembly2.cif.gz
Similar dimers

[Back to Home]