5dws/1/1:E/1:A

Sequences
>5dws-a1-m1-cE (length=35) [Search sequence]
GPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQ
>5dws-a1-m1-cA (length=37) [Search sequence]
LGPLPPGWEKRTDSNGRVYFVNHNTRITQWEDPRSQG
Structure information
PDB ID 5dws (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal Structure of ITCH WW3 domain in complex with TXNIP peptide
Assembly ID 1
Resolution 1.65Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 35
Sequence identity between the two chains 1.0
PubMed citation
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID E A
UniProt accession Q96J02 Q96J02
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
Function annotation BioLiP:5dwsE BioLiP:5dwsA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5dws-a1-m1-cE_5dws-a1-m1-cA.pdb.gz
Full biological assembly
Download: 5dws-assembly1.cif.gz

[Back to Home]