5dzk/2/1:3/1:m

Sequences
>5dzk-a2-m1-c3 (length=2) [Search sequence]
LL
>5dzk-a2-m1-cm (length=178) [Search sequence]
SLTDSVYERLLSERIIFLGSEVNDEIANRLCAQILLLAAEDASKDISLYINSPGGSISAG
MAIYDTMVLAPCDIATYAMGMAASMGEFLLAAGTKGKRYALPHARILMHQPLGGVTGSAA
DIAIQAEQFAVIKKEMFRLNAEFTGQPIERIEADSDRDRWFTAAEALEYGFVDHIITR
Structure information
PDB ID 5dzk (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of the active form of the proteolytic complex clpP1 and clpP2
Assembly ID 2
Resolution 3.07Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 21
Sequence identity between the two chains 1.0
PubMed citation 26858247
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID 3 m
UniProt accession P9WPC5
Species 32630 (synthetic construct) 83331 (Mycobacterium tuberculosis CDC1551)
Function annotation BioLiP:5dzkm
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5dzk-a2-m1-c3_5dzk-a2-m1-cm.pdb.gz
Full biological assembly
Download: 5dzk-assembly2.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5dzk/1/1:1/1:M 5dzk/1/1:2/1:N 5dzk/2/1:4/1:n 7x8x/2/1:0/1:T 7x8x/2/1:1/1:b 7x8x/2/1:2/1:a 7x8x/2/1:3/1:Z 7x8x/2/1:4/1:X

[Back to Home]