5e2x/10/1:F/5:H

Sequences

>5e2x-a10-m1-cF (length=94) [Search sequence]

QSVEEMYRHILQTQGPFDAILYYYMMTEEPIVFSTSDGKEYVYPDSLEGEHPPWLSEKEA LNEDNRFITMDDQQFYWPVMNHRNKFMAILQHHK

>5e2x-a10-m5-cH (length=101) [Search sequence]

MAKPHSEQSVEEMYRHILQTQGPFDAILYYYMMTEEPIVFSTSDGKEYVYPDSLEGEHPP WLSEKEALNEDNRFITMDDQQFYWPVMNHRNKFMAILQHHK

Structure information

PDB ID	5e2x (database links: RCSB PDB PDBe PDBj PDBsum)
Title	The crystal structure of the C-terminal domain of Ebola (Tai Forest) nucleoprotein
Assembly ID	10
Resolution	2.1Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	25
Sequence identity between the two chains	1.0

Chain information

	Chain 1	Chain 2
Model ID	1	5
Chain ID	F	H
UniProt accession	B8XCN6	B8XCN6
Species	186541 (Tai Forest ebolavirus)	186541 (Tai Forest ebolavirus)

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 5e2x-a10-m1-cF_5e2x-a10-m5-cH.pdb.gz

Full biological assembly Download: 5e2x-assembly10.cif.gz

Similar dimers

Other dimers with similar sequences and structures	5e2x/10/4:E/1:G 5e2x/9/1:B/1:D 5e2x/9/2:A/3:C
Other dimers with similar sequences but different poses	5e2x/9/1:B/2:A 5e2x/10/1:G/5:H