5e4g/1/1:A/2:A

Sequences
>5e4g-a1-m1-cA (length=108) [Search sequence]
LGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLV
QQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
>5e4g-a1-m2-cA (length=108) [Search sequence]
LGLDCDEHSSESRCCRYPLTVDFEAFGWDWIIAPKRYKANYCSGQCEYMFMQKYPHTHLV
QQANPRGSAGPCCTPTKMSPINMLYFNDKQQIIYGKIPGMVVDRCGCS
Structure information
PDB ID 5e4g (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of human growth differentiation factor 11 (GDF-11)
Assembly ID 1
Resolution 1.5Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 98
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 2
Chain ID A A
UniProt accession O95390 O95390
Species 9606 (Homo sapiens) 9606 (Homo sapiens)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5e4g-a1-m1-cA_5e4g-a1-m2-cA.pdb.gz
Full biological assembly
Download: 5e4g-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 3hh2/1/1:A/1:B 3sek/1/1:B/2:B 6mac/1/1:A/2:A 7mrz/1/1:A/2:A
Other dimers with similar sequences but different poses
  • 5f3h/2/1:L/1:K 5f3b/1/1:D/1:C 5f3h/1/1:I/1:J
  • [Back to Home]