5e4x/1/2:A/8:A

Sequences
>5e4x-a1-m2-cA (length=50) [Search sequence]
YAVAESVIGKRVGDDGKTIEYLVKWTDMSDATWEPQDNVDSTLVLLYQQQ
>5e4x-a1-m8-cA (length=50) [Search sequence]
YAVAESVIGKRVGDDGKTIEYLVKWTDMSDATWEPQDNVDSTLVLLYQQQ
Structure information
PDB ID 5e4x (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of cpSRP43 chromodomain 3
Assembly ID 1
Resolution 2.75Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 53
Sequence identity between the two chains 1.0
PubMed citation 26568381
Chain information
Chain 1 Chain 2
Model ID 2 8
Chain ID A A
UniProt accession O22265 O22265
Species 3702 (Arabidopsis thaliana) 3702 (Arabidopsis thaliana)
Function annotation BioLiP:5e4xA BioLiP:5e4xA
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Color: [By chain]   [By residue index]  
Spin: [Spin off]   [Spin on]   [Reset]
Render: [Low quality]   [High quality]  
Background: [Black]   [White]  
Download: 5e4x-a1-m2-cA_5e4x-a1-m8-cA.pdb.gz
Full biological assembly
Download: 5e4x-assembly1.cif.gz
Similar dimers
Other dimers with similar sequences and structures 5e4x/1/1:A/7:A 5e4x/1/1:A/8:A 5e4x/1/2:A/7:A 5e4x/1/3:A/5:A 5e4x/1/3:A/6:A 5e4x/1/4:A/5:A 5e4x/1/4:A/6:A

[Back to Home]