5e8i/2/1:D/1:J

Sequences

>5e8i-a2-m1-cD (length=93) [Search sequence]

GQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRA LRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQP

>5e8i-a2-m1-cJ (length=93) [Search sequence]

GQIQLWQFLLELLSDSANASCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRA LRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQP

Structure information

PDB ID	5e8i (database links: RCSB PDB PDBe PDBj PDBsum)
Title	Crystal structure of the DNA binding domain of human transcription factor FLI1 in complex with a 10-mer DNA ACCGGAAGTG
Assembly ID	2
Resolution	3.45Å
Method of structure determination	X-RAY DIFFRACTION
Number of inter-chain contacts	50
Sequence identity between the two chains	1.0
PubMed citation	26618620

Chain information

	Chain 1	Chain 2
Model ID	1	1
Chain ID	D	J
UniProt accession	Q01543	Q01543
Species	9606 (Homo sapiens)	9606 (Homo sapiens)
Function annotation	BioLiP:5e8iD	BioLiP:5e8iJ

3D structure

Dimer structure: Chain 1 in red; Chain 2 in blue. Download: 5e8i-a2-m1-cD_5e8i-a2-m1-cJ.pdb.gz

Full biological assembly Download: 5e8i-assembly2.cif.gz

Similar dimers

Other dimers with similar sequences and structures

4irg/1/1:A/2:A 4irh/1/1:A/2:A 5e8g/1/1:A/1:C 5e8g/2/1:B/1:D 5e8i/1/1:A/1:G