5efw/1/1:C/1:B

Sequences
>5efw-a1-m1-cC (length=49) [Search sequence]
TRAGAEIHSLPNLNVEQKFAFIVSLFDDPSQSANLLAEAKKLNDAQAPK
>5efw-a1-m1-cB (length=55) [Search sequence]
KFNKEKTRAGAEIHSLPNLNVEQKFAFIVSLFDDPSQSANLLAEAKKLNDAQAPK
Structure information
PDB ID 5efw (database links: RCSB PDB PDBe PDBj PDBsum)
Title Crystal structure of LOV2-Zdk1 - the complex of oat LOV2 and the affibody protein Zdark1
Assembly ID 1
Resolution 2.1Å
Method of structure determination X-RAY DIFFRACTION
Number of inter-chain contacts 46
Sequence identity between the two chains 1.0
Chain information
Chain 1 Chain 2
Model ID 1 1
Chain ID C B
UniProt accession
Species 1280 (Staphylococcus aureus) 1280 (Staphylococcus aureus)
3D structure
Switch viewer: [NGL] [JSmol]
Dimer structure: Chain 1 in red; Chain 2 in blue.
Download: 5efw-a1-m1-cC_5efw-a1-m1-cB.pdb.gz
Full biological assembly
Download: 5efw-assembly1.cif.gz

[Back to Home]